General Information

  • ID:  hor006526
  • Uniprot ID:  P01337
  • Protein name:  Insulin-1
  • Gene name:  ins1
  • Organism:  Batrachoididae sp. (Toadfish)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   unclassified Batrachoididae , Batrachoididae (family), Batrachoidiformes (order), Batrachoidaria , Percomorphaceae , Euacanthomorphacea , Acanthomorphata , Ctenosquamata , Eurypterygia , Neoteleostei , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  MAPPQHLCGSHLVDALYLVCGDRGFFYNPKGIVEQCCHRPCDIFDLQSYCN
  • Length:  51
  • Propeptide:  MAPPQHLCGSHLVDALYLVCGDRGFFYNPKGIVEQCCHRPCDIFDLQSYCN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  8-37; 20-50; 36-41
  • Structure ID:  AF-P01337-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P01337-F1.pdbhor006526_AF2.pdbhor006526_ESM.pdb

Physical Information

Mass: 666771 Formula: C254H379N69O72S7
Absent amino acids: TW Common amino acids: CL
pI: 6.2 Basic residues: 6
Polar residues: 17 Hydrophobic residues: 15
Hydrophobicity: -2.94 Boman Index: -5527
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 74.51
Instability Index: 5048.82 Extinction Coefficient cystines: 4845
Absorbance 280nm: 96.9

Literature

  • PubMed ID:  5949593
  • Title:  Species variation in the amino acid sequence of insulin.